PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000172303
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 54aa    MW: 6338.32 Da    PI: 4.2322
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000172303genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM644.5e-20652148
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                   lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwd+p
  MDP0000172303  6 LPPGFRFHPTDEELVAYYLDRKINGRTIEL-EIIPEVDLYKCEPWDFP 52
                   79****************************.99*************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-20452IPR003441NAC domain
PROSITE profilePS5100521.595654IPR003441NAC domain
PfamPF023659.7E-10749IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 54 aa     Download sequence    Send to blast
MAPISLPPGF RFHPTDEELV AYYLDRKING RTIELEIIPE VDLYKCEPWD FPVC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-162521161Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4656844e-41AM465684.2 Vitis vinifera contig VV78X155772.10, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104136.11e-30PREDICTED: NAC transcription factor 29-like
RefseqXP_010480185.11e-30PREDICTED: NAC domain-containing protein 86-like
RefseqXP_010480187.11e-30PREDICTED: NAC domain-containing protein 86-like
SwissprotQ9FFI51e-29NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM4CGK21e-30M4CGK2_BRARP; Uncharacterized protein
STRINGBra003335.1-P3e-30(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.18e-33NAC domain containing protein 28